Recombinant Human TNFSF9, StrepII-tagged
Cat.No. : | TNFSF9-286H |
Product Overview : | Purified human recombinant TNFSF9 protein (amino acids 50-254, 205 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 79.9 kDa. (Accession NP_003802.1; UniProt P41273) |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Strep II |
Protein Length : | 50-254, 205 a.a. |
Description : | TNFSF9 is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This transmembrane cytokine is a bidirectional signal transducer that acts as a ligand for TNFRSF9/4-1BB, which is a costimulatory receptor molecule in T lymphocytes. This cytokine and its receptor are involved in the antigen presentation process and in the generation of cytotoxic T cells. The receptor TNFRSF9/4-1BB is absent from resting T lymphocytes but rapidly expressed upon antigenic stimulation. The ligand encoded by this gene, TNFSF9/4-1BBL, has been shown to reactivate anergic T lymphocytes in addition to promoting T lymphocyte proliferation. This cytokine has also been shown to be required for the optimal CD8 responses in CD8 T cells. This cytokine is expressed in carcinoma cell lines, and is thought to be involved in T cell-tumor cell interaction. |
Form : | Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free) |
AA Sequence : | ACPWAVSGARASPGSAASPRLREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGL SYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGF QGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE |
Endotoxin : | <0.1 eu per μg protein by lal |
Purity : | 90% by SDS-PAGE |
Storage : | 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles. |
Reconstitution : | Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml |
Gene Name | TNFSF9 tumor necrosis factor (ligand) superfamily, member 9 [ Homo sapiens ] |
Official Symbol | TNFSF9 |
Synonyms | TNFSF9; tumor necrosis factor (ligand) superfamily, member 9; tumor necrosis factor ligand superfamily member 9; 4 1BB L; homolog of mouse 4 1BB L; receptor 4 1BB ligand; 4-1BBL; 4-1BB ligand; receptor 4-1BB ligand; homolog of mouse 4-1BB-L; CD137L; 4-1BB-L; |
Gene ID | 8744 |
mRNA Refseq | NM_003811 |
Protein Refseq | NP_003802 |
MIM | 606182 |
UniProt ID | P41273 |
Chromosome Location | 19p13.3 |
Pathway | Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; |
Function | cytokine activity; receptor binding; tumor necrosis factor receptor binding; |
◆ Recombinant Proteins | ||
Tnfsf9-88M | Active Recombinant Mouse Tnfsf9 Protein (Arg104-Glu309), C-His tagged, Animal-free, Carrier-free | +Inquiry |
TNFSF9-717HAF647 | Recombinant Human TNFSF9 Protein, Fc-tagged, Alexa Fluor 647 conjugated | +Inquiry |
TNFSF9-0249H | Recombinant Human TNFSF9 Protein (Arg71-Glu254), N-Fc-tagged | +Inquiry |
TNFSF9-3323H | Recombinant Human TNFSF9, GST-tagged | +Inquiry |
TNFSF9-155H | Recombinant Human TNFSF9 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFSF9-2810MCL | Recombinant Mouse TNFSF9 cell lysate | +Inquiry |
TNFSF9-1445RCL | Recombinant Rat TNFSF9 cell lysate | +Inquiry |
TNFSF9-1444RCL | Recombinant Rat TNFSF9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TNFSF9 Products
Required fields are marked with *
My Review for All TNFSF9 Products
Required fields are marked with *
0
Inquiry Basket