Recombinant Human TNFSF4 Protein, Fc-tagged

• Cat.No.: TNFSF4-689H
• Product Overview: Recombinant human TNFSF4 protein with Fc tag was expressed in HEK293.

Specification

• Description: This gene encodes a cytokine of the tumor necrosis factor (TNF) ligand family. The encoded protein functions in T cell antigen-presenting cell (APC) interactions and mediates adhesion of activated T cells to endothelial cells. Polymorphisms in this gene have been associated with Sjogren's syndrome and systemic lupus erythematosus. Alternative splicing results in multiple transcript variants.
• Source: HEK293
• Species: Human
• Tag: Fc
• Form: Lyophilized
• Molecular Mass: 42.9 kDa
• Protein length: 183
• AA Sequence: MERVQPLEENVGNAARPRFERNKLLLVASVIQGLGLLLCFTYICLHFSALQVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL
• Purity: > 98%
• Applications: WB; ELISA; FACS; FC
• Stability: This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
• Storage: At -20 centigrade.
• Concentration: 1 mg/mL
• Storage Buffer: PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
• Reconstitution: Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.

Gene Information

• Gene Name: TNFSF4 tumor necrosis factor (ligand) superfamily, member 4 [ Homo sapiens (human) ]
• Official Symbol: TNFSF4
• Synonyms: TNFSF4; tumor necrosis factor (ligand) superfamily, member 4; tax transcriptionally activated glycoprotein 1, 34kD , TXGP1; tumor necrosis factor ligand superfamily member 4; CD252; gp34; OX 40L; OX40L; CD134 ligand; glycoprotein Gp34; OX40 antigen ligand; TAX transcriptionally-activated glycoprotein 1; tax-transcriptionally activated glycoprotein 1 (34kD); GP34; OX4OL; TXGP1; CD134L; OX-40L
• Gene ID: 7292
• mRNA Refseq: NM_003326
• Protein Refseq: NP_003317
• MIM: 603594
• UniProt ID: P23510