Recombinant Human TNFSF18 Protein, Fc-tagged
Cat.No. : | TNFSF18-667H |
Product Overview : | Recombinant human TNFSF18 protein with Fc tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Fc |
Protein Length : | 199 |
Description : | The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for receptor TNFRSF18/AITR/GITR. It has been shown to modulate T lymphocyte survival in peripheral tissues. This cytokine is also found to be expressed in endothelial cells, and is thought to be important for interaction between T lymphocytes and endothelial cells. |
Form : | Lyophilized |
Molecular Mass : | 46.2 kDa |
AA Sequence : | MTLHPSPITCEFLFSTALISPKMCLSHLENMPLSHSRTQGAQRSSWKLWLFCSIVMLLFLCSFSWLIFIFLQLETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLANPQFIS |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Concentration : | 1 mg/mL |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | TNFSF18 tumor necrosis factor (ligand) superfamily, member 18 [ Homo sapiens (human) ] |
Official Symbol | TNFSF18 |
Synonyms | TNFSF18; tumor necrosis factor (ligand) superfamily, member 18; tumor necrosis factor ligand superfamily member 18; AITRL; hGITRL; TL6; AITR ligand; GITR ligand; activation-inducible TNF-related ligand; glucocorticoid-induced TNF-related ligand; glucocorticoid-induced TNFR-related protein ligand; GITRL; MGC138237; |
Gene ID | 8995 |
mRNA Refseq | NM_005092 |
Protein Refseq | NP_005083 |
MIM | 603898 |
UniProt ID | Q9UNG2 |
◆ Recombinant Proteins | ||
TNFSF18-6854H | Recombinant Human TNFSF18 protein, His-Flag-tagged | +Inquiry |
TNFSF18-151H | Recombinant Human TNFSF18 Protein, His-tagged | +Inquiry |
TNFSF18-667H | Recombinant Human TNFSF18 Protein, Fc-tagged | +Inquiry |
TNFSF18-104H | Recombinant Human TNFSF18 Protein, Gln50-Ser177, N-His-Flag tagged, Biotinylated | +Inquiry |
Tnfsf18-9486M | Recombinant Mouse Tnfsf18 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFSF18-890HCL | Recombinant Human TNFSF18 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TNFSF18 Products
Required fields are marked with *
My Review for All TNFSF18 Products
Required fields are marked with *
0
Inquiry Basket