Recombinant Human TNFRSF8

• Cat.No.: TNFRSF8-26927TH
• Product Overview: Recombinant fragment of Human CD30 with proprietarytag; Predicted MWt 38.06 kDa inclusive of tag.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 113 amino acids
• Description: The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is expressed by activated, but not by resting, T and B cells. TRAF2 and TRAF5 can interact with this receptor, and mediate the signal transduction that leads to the activation of NF-kappaB. This receptor is a positive regulator of apoptosis, and also has been shown to limit the proliferative potential of autoreactive CD8 effector T cells and protect the body against autoimmunity. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported.
• Molecular Weight: 38.060kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: QDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPA
• Sequence Similarities: Contains 6 TNFR-Cys repeats.

Gene Information

• Gene Name: TNFRSF8 tumor necrosis factor receptor superfamily, member 8 [ Homo sapiens ]
• Official Symbol: TNFRSF8
• Synonyms: TNFRSF8; tumor necrosis factor receptor superfamily, member 8; CD30, D1S166E; tumor necrosis factor receptor superfamily member 8; KI 1
• Gene ID: 943
• mRNA Refseq: NM_001243
• Protein Refseq: NP_001234
• MIM: 153243
• Uniprot ID: P28908
• Chromosome Location: 1p36
• Pathway: Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; TNF-alpha/NF-kB Signaling Pathway, organism-specific biosystem
• Function: binding; receptor activity; transmembrane signaling receptor activity; tumor necrosis factor-activated receptor activity