| Species : |
Human |
| Source : |
Yeast |
| Tag : |
Fc |
| Protein Length : |
412 |
| Description : |
Osteoprotegerin (OPG), also named osteoclastogenesis inhibitory factor (OCIF), and tumor necrosis factor receptor superfamily member 11B (TNFRSF11B), is a TNFRSF11B-encoded protein in humans. OPG is a 401 a.a. basic glycoprotein which comprises 7 structural domains. It is either a 60 kDa monomer or a 120 kDa dimer linked by disulfide bridges. OPG acts as a decoy receptor for the receptor activator of nuclear factor kappa B ligand (RANKL) and inhibits the activation of osteoclasts and promotes osteoclast apoptosis in vitro and may also play a role in preventing arterial calcification. OPG has been applied to decrease bone resorption in women with postmenopausal osteoporosis and in patients with lytic bone metastases. Mature human OPG shares 86 %, 87 %, 92 %, 92 % and 88 % amino acid sequence identity with mouse, rat, equine, canine and bovine OPG, respectively. |
| Form : |
Lyophilized from a 0.2μm filtered concentrated solution in 20 mM PB, pH 6.0, 150 mM NaCl, 0.02 % Tween-80. |
| Bio-activity : |
Fully biologically active when compared to standard. The ED50 as determined by neutralizing the stimulation of U937 cells is less than 10 ng/ml, corresponding to a specific activity of > 1.0 × 10⁵ IU/mg in the presence of 10 ng/mL soluble rHuRANKL (sRANKL). |
| Molecular Mass : |
Approximately 109.6 kDa, a disulfide-linked homodimeric protein containing two 412 amino acids. |
| AA Sequence : |
ETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGNSESTQKCGIDVTLEPKSSDKTHTCPPCPAPEFEGAPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPTPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Endotoxin : |
Less than 1 EU/μg of rHuOPG-Fc as determined by LAL method. |
| Purity : |
>95% by SDS-PAGE and HPLC analysis. |
| Storage : |
Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
| Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20centigrade. Further dilutions should be made in appropriate buffered solutions. |
