Recombinant Human TNFRSF11B protein(91-160 aa), N-MBP & C-His-tagged

• Cat.No.: TNFRSF11B-2454H
• Product Overview: Recombinant Human TNFRSF11B protein(O00300)(91-160 aa), fused with N-terminal MBP tag and C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&MBP
• Protein Length: 91-160 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: QYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPC

Gene Information

• Gene Name: TNFRSF11B tumor necrosis factor receptor superfamily, member 11b [ Homo sapiens ]
• Official Symbol: TNFRSF11B
• Synonyms: TNFRSF11B; tumor necrosis factor receptor superfamily, member 11b; OPG, osteoprotegerin; tumor necrosis factor receptor superfamily member 11B; OCIF; TR1; osteoprotegerin; osteoclastogenesis inhibitory factor; OPG; MGC29565
• Gene ID: 4982
• mRNA Refseq: NM_002546
• Protein Refseq: NP_002537
• MIM: 602643
• UniProt ID: O00300