Recombinant Human TNFRSF11B protein

Cat.No. : TNFRSF11B-5526H
Product Overview : Recombinant Human TNFRSF11B protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 173
Description : Osteoprotegerin (OPG), also named osteoclastogenesis inhibitory factor (OCIF), and tumor necrosis factor receptor superfamily member 11B (TNFRSF11B), is a TNFRSF11B-encoded protein in humans. OPG is a 401 a.a. basic glycoprotein which comprises 7 structural domains. It is either a 60 kDa monomer or a 120 kDa dimer linked by disulfide bridges. OPG acts as a decoy receptor for the receptor activator of nuclear factor kappa B ligand (RANKL) and inhibits the activation of osteoclasts and promotes osteoclast apoptosis in vitro and may also play a role in preventing arterial calcification. OPG has been applied to decrease bone resorption in women with postmenopausal osteoporosis and in patients with lytic bone metastases. Mature human OPG shares 86 %, 87 %, 92 %, 92 % and 88 % amino acid sequence identity with mouse, rat, equine, canine and bovine OPG, respectively.
Form : Lyophilized from a 0.2μm filtered concentrated solution in 20 mM PB,150 mM NaCl, pH 6.0.
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by neutralizing the stimulation of U937 cells is less than 10 ng/ml, corresponding to a specific activity of > 1.0 × 10⁵ IU/mg in the presence of 10 ng/mL soluble rHuRANKL (sRANKL).
Molecular Mass : Approximately 19.7 kDa, a single non-glycosylated polypeptide chain containing 173 amino acids.
AA Sequence : ETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGNSESTQK
Endotoxin : Less than 1 EU/μg of rHuOPG as determined by LAL method.
Purity : >95% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name TNFRSF11B
Official Symbol TNFRSF11B
Synonyms TNFRSF11B; tumor necrosis factor receptor superfamily, member 11b; OPG, osteoprotegerin; tumor necrosis factor receptor superfamily member 11B; OCIF; TR1; osteoprotegerin; osteoclastogenesis inhibitory factor; OPG; MGC29565;
Gene ID 4982
mRNA Refseq NM_002546
Protein Refseq NP_002537
MIM 602643
UniProt ID O00300

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All TNFRSF11B Products

Required fields are marked with *

My Review for All TNFRSF11B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon