Recombinant Human TNFRSF11A protein, hFc-Flag-tagged

• Cat.No.: TNFRSF11A-5743H
• Product Overview: Recombinant Human TNFRSF11A protein(Q9Y6Q6)(30-212aa), fused with C-terminal hFc and Flag tag, was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: Fc&Flag
• Protein Length: 30-212aa
• Tag: C-hFc-Flag
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 50.0 kDa
• Purity: Greater than 90% as determined by SDS-PAGE.
  Greater than 90% as determined by SEC-HPLC.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: IAPPCTSEKHYEHLGRCCNKCEPGKYMSSKCTTTSDSVCLPCGPDEYLDSWNEEDKCLLHKVCDTGKALVAVVAGNSTTPRRCACTAGYHWSQDCECCRRNTECAPGLGAQHPLQLNKDTVCKPCLAGYFSDAFSSTDKCRPWTNCTFLGKRVEHHGTEKSDAVCSSSLPARKPPNEPHVYLP

Gene Information

• Gene Name: TNFRSF11A tumor necrosis factor receptor superfamily, member 11a, NFKB activator [ Homo sapiens ]
• Official Symbol: TNFRSF11A
• Synonyms: TNFRSF11A; tumor necrosis factor receptor superfamily, member 11a, NFKB activator; tumor necrosis factor receptor superfamily, member 11a, activator of NFKB; tumor necrosis factor receptor superfamily member 11A; CD265; RANK; receptor activator of NF-KB; osteoclast differentiation factor receptor; receptor activator of nuclear factor-kappa B; loss of heterozygosity, 18, chromosomal region 1; FEO; OFE; ODFR; OSTS; PDB2; OPTB7; TRANCER; LOH18CR1
• Gene ID: 8792
• mRNA Refseq: NM_003839
• Protein Refseq: NP_003830
• MIM: 603499
• UniProt ID: Q9Y6Q6