Recombinant Human TNFRSF10B protein
Cat.No. : | TNFRSF10B-311H |
Product Overview : | Recombinant Human TNFRSF10B protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 132 |
Description : | Tumor necrosis factor-related apoptosis-inducing ligand Receptor 2 (TRAIL-R2) is a cell-surface receptor involved in tumor necrosis factor-related apoptosis-inducing ligand (TRAIL)-induced cell-death signaling. The death ligand TRAIL bears high potential as a new anticancer agent, as binding to the death receptors TRAIL-R1 or TRAIL-R2 triggers apoptosis in most cancer cells. TRAIL-R2 has been shown to be associated with a decrease in the survival rates of breast cancer patients. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4. |
Bio-activity : | Fully biologically active when compared to standard. rHusTRAIL-R2 reduced the production of LPS-induced TNF by its ability to neutralize endogenous TRAIL in fresh human PBMC. In this assay, endogenous TRAIL is induced during a 24 hour exposure to LPS (10 ng/mL) but in the presence of rHusTRAIL-R2, TRAIL-induced TNF is suppressed. |
Molecular Mass : | Approximately 14.8 kDa, a single non-glycosylated polypeptide chain containing 132 amino acids. |
AA Sequence : | ESALITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHKES |
Endotoxin : | Less than 1 EU/μg of rHusTRAIL-R2 as determined by LAL method. |
Purity : | >97% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | TNFRSF10B |
Official Symbol | TNFRSF10B |
Synonyms | TNFRSF10B; tumor necrosis factor receptor superfamily, member 10b; tumor necrosis factor receptor superfamily member 10B; CD262; DR5; KILLER; TRAIL R2; TRICK2A; TRICKB; Fas-like protein; death receptor 5; cytotoxic TRAIL receptor-2; apoptosis inducing receptor TRAIL-R2; apoptosis inducing protein TRICK2A/2B; TNF-related apoptosis-inducing ligand receptor 2; death domain containing receptor for TRAIL/Apo-2L; tumor necrosis factor receptor-like protein ZTNFR9; p53-regulated DNA damage-inducible cell death receptor(killer); TRICK2; ZTNFR9; TRAILR2; TRICK2B; TRAIL-R2; KILLER/DR5; |
Gene ID | 8795 |
mRNA Refseq | NM_003842 |
Protein Refseq | NP_003833 |
MIM | 603612 |
UniProt ID | O14763 |
◆ Recombinant Proteins | ||
Tnfrsf10b-7762M | Recombinant Mouse Tnfrsf10b protein, His-tagged | +Inquiry |
TNFRSF10B-5248H | Recombinant Human TNFRSF10B Protein (Met1-Glu182), C-Fc tagged | +Inquiry |
TNFRSF10B-598H | Active Recombinant Human TNFRSF10B, Fc-tagged, Biotinylated | +Inquiry |
TNFRSF10B-1639R | Recombinant Rhesus Monkey TNFRSF10B Protein, hIgG4-tagged | +Inquiry |
TNFRSF10B-310H | Recombinant Human TNFRSF10B Protein, Fc/His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFRSF10B-2829HCL | Recombinant Human TNFRSF10B cell lysate | +Inquiry |
TNFRSF10B-2397MCL | Recombinant Mouse TNFRSF10B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TNFRSF10B Products
Required fields are marked with *
My Review for All TNFRSF10B Products
Required fields are marked with *
0
Inquiry Basket