Recombinant Human TNFAIP8 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: TNFAIP8-6568H
• Product Overview: TNFAIP8 MS Standard C13 and N15-labeled recombinant protein (NP_055165) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: Acts as a negative mediator of apoptosis and may play a role in tumor progression. Suppresses the TNF-mediated apoptosis by inhibiting caspase-8 activity but not the processing of procaspase-8, subsequently resulting in inhibition of BID cleavage and caspase-3 activation.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 23 kDa
• AA Sequence: MHSEAEESKEVATDVFNSKNLAVQAQKKILGKMVSKSIATTLIDDTSSEVLDELYRVTREYTQNKKEAEKIIKNLIKTVIKLAILYRNNQFNQDELALMEKFKKKVHQLAMTVVSFHQVDYTFDRNVLSRLLNECREMLHQIIQRHLTAKSHGRVNNVFDHFSDCEFLAALYNPFGNFKPHLQKLCDGINKMLDEENITRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: TNFAIP8 TNF alpha induced protein 8 [ Homo sapiens (human) ]
• Official Symbol: TNFAIP8
• Synonyms: TNFAIP8; tumor necrosis factor, alpha-induced protein 8; tumor necrosis factor alpha-induced protein 8; GG2 1; MDC 3.13; SCC S2; NDED; TNF-induced protein GG2-1; TNF alpha-induced protein 8; NF-kappa-B-inducible DED-containing protein; head and neck tumor and metastasis-related protein; GG2-1; SCCS2; SCC-S2; MDC-3.13
• Gene ID: 25816
• mRNA Refseq: NM_014350
• Protein Refseq: NP_055165
• MIM: 612111
• UniProt ID: O95379