Recombinant Human TNFAIP3 Protein, GST-tagged

• Cat.No.: TNFAIP3-2156H
• Product Overview: Human TNFAIP3 partial ORF ( NP_006281, 691 a.a. - 790 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene was identified as a gene whose expression is rapidly induced by the tumor necrosis factor (TNF). The protein encoded by this gene is a zinc finger protein and ubiqitin-editing enzyme, and has been shown to inhibit NF-kappa B activation as well as TNF-mediated apoptosis. The encoded protein, which has both ubiquitin ligase and deubiquitinase activities, is involved in the cytokine-mediated immune and inflammatory responses. Several transcript variants encoding the same protein have been found for this gene.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Form: Liquid
• Molecular Mass: 36.74 kDa
• AA sequence: RTEEQLRSSQRRDVPRTTQSTSRPKCARASCKNILACRSEELCMECQHPNQRMGPGAHRGEPAPEDPPKQRCRAPACDHFGNAKCNGYCNECFQFKQMYG
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: TNFAIP3 tumor necrosis factor, alpha-induced protein 3 [ Homo sapiens ]
• Official Symbol: TNFAIP3
• Synonyms: TNFAIP3; tumor necrosis factor, alpha-induced protein 3; tumor necrosis factor alpha-induced protein 3; A20; OTUD7C; TNFAIP3 (A20); zinc finger protein A20; TNF alpha-induced protein 3; OTU domain-containing protein 7C; putative DNA-binding protein A20; tumor necrosis factor inducible protein A20; TNFA1P2; MGC104522; MGC138687; MGC138688
• Gene ID: 7128
• mRNA Refseq: NM_006290
• Protein Refseq: NP_006281
• MIM: 191163
• UniProt ID: P21580