Recombinant Human TNF Protein

• Cat.No.: TNF-62H
• Product Overview: Recombinant Human TNF Protein was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Description: This gene encodes a multifunctional proinflammatory cytokine that belongs to the tumor necrosis factor (TNF) superfamily. This cytokine is mainly secreted by macrophages. It can bind to, and thus functions through its receptors TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. This cytokine is involved in the regulation of a wide spectrum of biological processes including cell proliferation, differentiation, apoptosis, lipid metabolism, and coagulation. This cytokine has been implicated in a variety of diseases, including autoimmune diseases, insulin resistance, psoriasis, rheumatoid arthritis ankylosing spondylitis, tuberculosis, autosomal dominant polycystic kidney disease, and cancer. Mutations in this gene affect susceptibility to cerebral malaria, septic shock, and Alzheimer disease. Knockout studies in mice also suggested the neuroprotective function of this cytokine.
• Form: Liquid. In 100 mM Tris-HCl pH8.0, 100 mM NaH2PO4.
• Molecular Mass: ~55.6 kDa
• AA Sequence: MTHHHHHHAGGAENLYFQGSACDCRGDCFCGGGSVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIALVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIALVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
• Purity: >90%
• Storage: Short Term Storage at 4 centigrade, Long Term, please prepare aliquots with 20% glycerol and store at -20 to -80 centigrade. Avoid freeze/thaw cycles.
• Concentration: 0.05 mg/ml
• Official Full Name: Tumor necrosis factor

Gene Information

• Gene Name: TNF tumor necrosis factor [ Homo sapiens (human) ]
• Official Symbol: TNF
• Synonyms: DIF; TNFA; TNFSF2; TNLG1F; TNF-alpha
• Gene ID: 7124
• mRNA Refseq: NM_000594
• Protein Refseq: NP_000585
• MIM: 191160
• UniProt ID: P01375