Recombinant Human TMUB1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | TMUB1-2444H |
Product Overview : | TMUB1 MS Standard C13 and N15-labeled recombinant protein (NP_001129516) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Involved in sterol-regulated ubiquitination and degradation of HMG-CoA reductase HMGCR. Involved in positive regulation of AMPA-selective glutamate receptor GRIA2 recycling to the cell surface. Acts as negative regulator of hepatocyte growth during regeneration. |
Molecular Mass : | 26.1 kDa |
AA Sequence : | MTLIEGVGDEVTVLFSVLACLLVLALAWVSTHTAEGGDPLPQPSGTPTPSQPSAAMAATDSMRGEAPGAETPSLRHRGQAAQPEPSTGFTATPPAPDSPQEPLVLRLKFLNDSEQVARAWPHDTIGSLKRTQFPGREQQVRLIYQGQLLGDDTQTLGSLHLPPNCVLHCHVSTRVGPPNPPCPPGSEPGPSGLEIGSLLLPLLLLLLLLLWYCQIQYRPFFPLTATLGLAGFTLLLSLLAFAMYRPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | TMUB1 transmembrane and ubiquitin-like domain containing 1 [ Homo sapiens (human) ] |
Official Symbol | TMUB1 |
Synonyms | TMUB1; transmembrane and ubiquitin-like domain containing 1; C7orf21, chromosome 7 open reading frame 21; transmembrane and ubiquitin-like domain-containing protein 1; SB144; ubiquitin-like protein DULP; ubiquitin-like protein SB144; hepatocyte odd protein shuttling protein; C7orf21; MGC5442; |
Gene ID | 83590 |
mRNA Refseq | NM_001136044 |
Protein Refseq | NP_001129516 |
MIM | 614792 |
UniProt ID | Q9BVT8 |
◆ Cell & Tissue Lysates | ||
TMUB1-1800HCL | Recombinant Human TMUB1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TMUB1 Products
Required fields are marked with *
My Review for All TMUB1 Products
Required fields are marked with *
0
Inquiry Basket