Recombinant Human TMUB1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: TMUB1-2444H
• Product Overview: TMUB1 MS Standard C13 and N15-labeled recombinant protein (NP_001129516) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: Involved in sterol-regulated ubiquitination and degradation of HMG-CoA reductase HMGCR. Involved in positive regulation of AMPA-selective glutamate receptor GRIA2 recycling to the cell surface. Acts as negative regulator of hepatocyte growth during regeneration.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 26.1 kDa
• AA Sequence: MTLIEGVGDEVTVLFSVLACLLVLALAWVSTHTAEGGDPLPQPSGTPTPSQPSAAMAATDSMRGEAPGAETPSLRHRGQAAQPEPSTGFTATPPAPDSPQEPLVLRLKFLNDSEQVARAWPHDTIGSLKRTQFPGREQQVRLIYQGQLLGDDTQTLGSLHLPPNCVLHCHVSTRVGPPNPPCPPGSEPGPSGLEIGSLLLPLLLLLLLLLWYCQIQYRPFFPLTATLGLAGFTLLLSLLAFAMYRPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: TMUB1 transmembrane and ubiquitin-like domain containing 1 [ Homo sapiens (human) ]
• Official Symbol: TMUB1
• Synonyms: TMUB1; transmembrane and ubiquitin-like domain containing 1; C7orf21, chromosome 7 open reading frame 21; transmembrane and ubiquitin-like domain-containing protein 1; SB144; ubiquitin-like protein DULP; ubiquitin-like protein SB144; hepatocyte odd protein shuttling protein; C7orf21; MGC5442
• Gene ID: 83590
• mRNA Refseq: NM_001136044
• Protein Refseq: NP_001129516
• MIM: 614792
• UniProt ID: Q9BVT8