Recombinant Human TMPRSS11D, His-tagged

• Cat.No.: TMPRSS11D-22H
• Product Overview: Recombinant Human Airway Trypsin-like Protease/HAT is produced with our mammalian expression system in human cells. The target protein is expressed with sequence (Ala42-Ile418) of Human HAT fused with a 6His tag at the C-terminus.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Description: Airway Trypsin-Like Protease (HAT) is a single-pass type II membrane protein that belongs to the peptidase S1 family. HAT contains one peptidase S1 domain and one SEA domain. HAT is strongly inhibited by diisopropyl fluorophosphate, leupeptin, antipain, aprotinin and soybean trypsin inhibitor. HAT may play some biological roles in the host defense system on the mucous membrane independently of or in cooperation with other substances in airway mucous or bronchial secretions
• Form: Supplied as a 0.2 μM filtered solution of 20mM Tris-HCl, 150mM NaCl, 10% Glycerol, pH 7.5
• AA Sequence: AFDQKSYFYRSSFQLLNVEYNSQLNSPATQEYRTLSGRIESLITKTFKESNLRNQFIRAHVAKLR QDGSGVRADVVMKFQFTRNNNGASMKSRIESVLRQMLNNSGNLEINPSTEITSLTDQAAANWLIN ECGAGPDLITLSEQRILGGTEAEEGSWPWQVSLRLNNAHHCGGSLINNMWILTAAHCFRSNSNPR DWIATSGISTTFPKLRMRVRNILIHNNYKSATHENDIALVRLENSVTFTKDIHSVCLPAATQNIP PGSTAYVTGWGAQEYAGHTVPELRQGQVRIISNDVCNAPHSYNGAILSGMLCAGVPQGGVDACQG DSGGPLVQEDSRRLWFIVGIVSWGDQCGLPDKPGVYTRVTAYLDWIRQQTGIVDHHHHHH
• Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
• Purity: Greater than 95% as determined by reducing SDS-PAGE.
• Storage: Store at Please minimize freeze-thaw cycles.

Gene Information

• Gene Name: TMPRSS11D transmembrane protease, serine 11D [ Homo sapiens ]
• Official Symbol: TMPRSS11D
• Synonyms: TMPRSS11D; transmembrane protease, serine 11D; transmembrane protease serine 11D; airway trypsin like protease; airway trypsin-like protease; HAT; MGC150587; MGC150588
• Gene ID: 9407
• mRNA Refseq: NM_004262
• Protein Refseq: NP_004253
• MIM: 605369
• UniProt ID: O60235
• Chromosome Location: 4q13.2
• Function: peptidase activity; serine-type endopeptidase activity