Recombinant Human TMPO protein(411-480 aa), C-His-tagged

Cat.No. : TMPO-2759H
Product Overview : Recombinant Human TMPO protein(P42166)(411-480 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 411-480 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : RIDQSKFQETEFLSPPRKVPRLSEKSVEERDSGSFVAFQNIPGSELMSSFAKTVVSHSLTTLGLEVAKQS
Gene Name TMPO thymopoietin [ Homo sapiens ]
Official Symbol TMPO
Synonyms TMPO; thymopoietin; LAP2; LEM domain containing 4; LEMD4; TP; TP alpha; TP beta/gamma; lamina-associated polypeptide 2; thymopoietin-related peptide isoform alpha; thymopoietin-related peptide isoforms beta/gamma; CMD1T; PRO0868; MGC61508;
Gene ID 7112
mRNA Refseq NM_001032283
Protein Refseq NP_001027454
MIM 188380
UniProt ID P42166

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All TMPO Products

Required fields are marked with *

My Review for All TMPO Products

Required fields are marked with *

0

Inquiry Basket

cartIcon