Recombinant Human TMOD2 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: TMOD2-6416H
• Product Overview: TMOD2 MS Standard C13 and N15-labeled recombinant protein (NP_055363) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: This gene encodes a neuronal-specific member of the tropomodulin family of actin-regulatory proteins. The encoded protein caps the pointed end of actin filaments preventing both elongation and depolymerization. The capping activity of this protein is dependent on its association with tropomyosin. Alternatively spliced transcript variants encoding different isoforms have been described.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 39.6 kDa
• AA Sequence: MALPFQKELEKYKNIDEDELLGKLSEEELKQLENVLDDLDPESAMLPAGFRQKDQTQKAATGPFDREHLLMYLEKEALEQKDREDFVPFTGEKKGRVFIPKEKPIETRKEEKVTLDPELEEALASASDTELYDLAAVLGVHNLLNNPKFDEETANNKGGKGPVRNVVKGEKVKPVFEEPPNPTNVEISLQQMKANDPSLQEVNLNNIKNIPIPTLREFAKALETNTHVKKFSLAATRSNDPVAIAFADMLKVNKTLTSLNIESNFITGTGILALVEALKENDTLTEIKIDNQRQQLGTAVEMEIAQMLEENSRILKFGYQFTKQGPRTRVAAAITKNNDLVRKKRVEADRRTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: TMOD2 tropomodulin 2 [ Homo sapiens (human) ]
• Official Symbol: TMOD2
• Synonyms: TMOD2; tropomodulin 2 (neuronal); tropomodulin-2; NTMOD; neuronal tropomodulin; N-TMOD; MGC39481
• Gene ID: 29767
• mRNA Refseq: NM_014548
• Protein Refseq: NP_055363
• MIM: 602928
• UniProt ID: Q9NZR1