Recombinant Human TMIGD2 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: TMIGD2-2837H
• Product Overview: TMIGD2 MS Standard C13 and N15-labeled recombinant protein (NP_653216) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: Plays a role in cell-cell interaction, cell migration, and angiogenesis. Through interaction with HHLA2, costimulates T-cells in the context of TCR-mediated activation. Enhances T-cell proliferation and cytokine production via an AKT-dependent signaling cascade.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 30.7 kDa
• AA Sequence: MGSPGMVLGLLVQIWALQEASSLSVQQGPNLLQVRQGSQATLVCQVDQATAWERLRVKWTKDGAILCQPYITNGSLSLGVCGPQGRLSWQAPSHLTLQLDPVSLNHSGAYVCWAAVEIPELEEAEGNITRLFVDPDDPTQNRNRIASFPGFLFVLLGVGSMGVAAIVWGAWFWGRRSCQQRDSGNSPGNAFYSNVLYRPRGPPKKSEDCSGEGKDQRGQSIYSTSFPQPAPRQPHLASRPCPSPRPCPSPRPGHPVSMVRVSPRPSPTQQPRPKGFPKVGEETRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: TMIGD2 transmembrane and immunoglobulin domain containing 2 [ Homo sapiens (human) ]
• Official Symbol: TMIGD2
• Synonyms: TMIGD2; transmembrane and immunoglobulin domain containing 2; CD28H; IGPR1; IGPR-1; transmembrane and immunoglobulin domain-containing protein 2; CD28 homolog; CD28 homologue; immunoglobulin and proline-rich receptor 1; immunoglobulin-containing and proline-rich receptor 1; transmembrane and immunoglobulin domain-containing protein 2 variant 2; transmembrane and immunoglobulin domain-containing protein 2 variant 3
• Gene ID: 126259
• mRNA Refseq: NM_144615
• Protein Refseq: NP_653216
• MIM: 614715
• UniProt ID: Q96BF3