Recombinant Human TMIE protein, GST-tagged

• Cat.No.: TMIE-2111H
• Product Overview: Recombinant Human TMIE protein(79-156 aa), fused with N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E. coli
• Tag: GST
• Protein Length: 79-156 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH).
• AASequence: NCRVPRTRKEIEARYLQRKAAKMYTDKLETVPPLNELTEVPGEDKKKKKKKKDSVDTVAIKVEEDEKNEAKKKKGEK
• Purity: 85%, by SDS-PAGE.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: TMIE transmembrane inner ear [ Homo sapiens ]
• Official Symbol: TMIE
• Synonyms: TMIE; transmembrane inner ear; deafness, autosomal recessive 6 , DFNB6; transmembrane inner ear expressed protein; transmembrane inner ear protein; DFNB6
• mRNA Refseq: NM_147196
• Protein Refseq: NP_671729
• MIM: 607237
• UniProt ID: Q8NEW7
• Gene ID: 259236