Recombinant Human TMEM2 protein, His-tagged

• Cat.No.: TMEM2-3592H
• Product Overview: Recombinant Human TMEM2 protein(Q9UHN6)(104-250aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 104-250aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 21.5 kDa
• AA Sequence: SSKYAPDENCPDQNPRLRNWDPGQDSAKQVVIKEGDMLRLTSDATVHSIVIQDGGLLVFGDNKDGSRNITLRTHYILIQDGGALHIGAEKCRYKSKATITLYGKSDEGESMPTFGKKFIGVEAGGTLELHGARKASWTLLARTLNSS
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: TMEM2 transmembrane protein 2 [ Homo sapiens ]
• Official Symbol: TMEM2
• Synonyms: TMEM2; transmembrane protein 2
• Gene ID: 23670
• mRNA Refseq: NM_001135820
• Protein Refseq: NP_001129292
• MIM: 605835
• UniProt ID: Q9UHN6