Recombinant Human TMEM189-UBE2V1 Protein, GST-tagged

• Cat.No.: TMEM189-UBE2V1-4789H
• Product Overview: Human Kua-UEV partial ORF ( NP_954673, 94 a.a. - 164 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 94-164 a.a.
• Description: The TMEM189-UEV mRNA is an infrequent but naturally occurring co-transcribed product of the neighboring TMEM189 and UBE2V1 genes. Ubiquitin-conjugating E2 enzyme variant proteins constitute a distinct subfamily within the E2 protein family. They have sequence similarity to other ubiquitin-conjugating enzymes but lack the conserved cysteine residue that is critical for the catalytic activity of E2s. The protein produced by this transcript has UEV1 B domains but the protein is localized to the cytoplasm rather than to the nucleus. The significance of this co-transcribed mRNA and the function of its protein product has not yet been determined. [provided by RefSeq
• Molecular Mass: 33.55 kDa
• AA Sequence: VHWGADTWGSVELPIVGKAFIRPFREHHIDPTAITRHDFIETNGDNCLVTLLPLLNMAYKFRTHSPEALEQ
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: TMEM189-UBE2V1 TMEM189-UBE2V1 readthrough [ Homo sapiens (human) ]
• Official Symbol: TMEM189-UBE2V1
• Synonyms: TMEM189-UBE2V1; TMEM189-UBE2V1 readthrough; CROC1B; CROC-1B; KUA-UEV; TMEM189-UBE2V1 fusion protein; TMEM189-UBE2V1 readthrough transcript; transmembrane protein 189-ubiquitin-conjugating enzyme E2 variant 1 read-through
• Gene ID: https://www.ncbi.nlm.nih.gov/gene/?term=387522
• mRNA Refseq: NM_199203
• Protein Refseq: NP_954673
• UniProt ID: U39361