Recombinant Human TMEM187 Protein, GST-tagged

• Cat.No.: TMEM187-2185H
• Product Overview: Human CXorf12 full-length ORF ( AAH08203, 1 a.a. - 261 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene consists of two exons and encodes a multi-pass membrane protein. An alternatively spliced transcript variant encoding the same protein has been found, but its biological validity is not determined. [provided by RefSeq, May 2010]
• Molecular Mass: 54.45 kDa
• AA Sequence: MNPEWGQAFVHVAVAGGLCAVAVFTGIFDSVSVQVGYEHYAEAPVAGLPAFLAMPFNSLVNMAYTLLGLSWLHRGGAMGLGPRYLKDVFAAMALLYGPVQWLRLWTQWRRAAVLDQWLTLPIFAWPVAWCLYLDRGWRPWLFLSLECVSLASYGLALLHPQGFEVALGAHVVAAVGQALRTHRHYGSTTSATYLALGVLSCLGFVVLKLCDHQLARWRLFQCLTGHFWSKVCDVLQFHFAFLFLTHFNTHPRFHPSGGKTR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: TMEM187 transmembrane protein 187 [ Homo sapiens ]
• Official Symbol: TMEM187
• Synonyms: TMEM187; transmembrane protein 187; chromosome X open reading frame 12 , CXorf12; DXS9878E; ITBA1; CXorf12; FLJ95849
• Gene ID: 8269
• mRNA Refseq: NM_003492
• Protein Refseq: NP_003483
• MIM: 300059
• UniProt ID: Q14656