Recombinant Human TMEM123 protein, GST-tagged

• Cat.No.: TMEM123-301360H
• Product Overview: Recombinant Human TMEM123 (27-146 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: His27-Ser146
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: HESAAMAASANIENSGLPHNSSANSTETLQHVPSDHTNETSNSTVKPPTSVASDSSNTTVTTMKPTAASNTTTPGMVSTNMTSTTLKSTPKTTSVSQNTSQISTSTMTVTHNSSVTSAAS
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: TMEM123 transmembrane protein 123 [ Homo sapiens ]
• Official Symbol: TMEM123
• Synonyms: TMEM123; transmembrane protein 123; porimin; KCT3; PORIMIN; pro oncosis receptor inducing membrane injury gene; KCT-3; serine/threonine-rich receptor; pro oncosis receptor inducing membrane injury; pro-oncosis receptor inducing membrane injury; keratinocytes associated transmembrane protein 3; keratinocytes-associated transmembrane protein 3; PORMIN
• Gene ID: 114908
• mRNA Refseq: NM_052932
• Protein Refseq: NP_443164
• MIM: 606356
• UniProt ID: Q8N131