Recombinant Human TMED6 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | TMED6-4148H |
Product Overview : | TMED6 MS Standard C13 and N15-labeled recombinant protein (NP_653277) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | TMED6 (Transmembrane P24 Trafficking Protein 6) is a Protein Coding gene. An important paralog of this gene is ENSG00000259900. |
Molecular Mass : | 27.6 kDa |
AA Sequence : | MSPLLFGAGLVVLNLVTSARSQKTEPLSGSGDQPLFRGADRYDFAIMIPPGGTECFWQFAHQTGYFYFSCEVQRTVGMSHDRHVAATAHNPQGFLIDTSQGVRGQINFSTQETGFYQLCLSNQHNHFGSVQVYLNFGVFYEGPETDHKQKERKQLNDTLDAIEDGTQKVQNNIFHMWRYYNFARMRKMADFFLIQSNYNYVNWWSTAQSLVIILSGILQLYFLKRLFNVPTTTDTKKPRCTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | TMED6 transmembrane p24 trafficking protein 6 [ Homo sapiens (human) ] |
Official Symbol | TMED6 |
Synonyms | TMED6; transmembrane p24 trafficking protein 6; p24g5; PRO34237; SPLL9146; transmembrane emp24 domain-containing protein 6; p24 family protein gamma-5; p24gamma5; transmembrane emp24 protein transport domain containing 6 |
Gene ID | 146456 |
mRNA Refseq | NM_144676 |
Protein Refseq | NP_653277 |
UniProt ID | Q8WW62 |
◆ Recombinant Proteins | ||
TMED6-4148H | Recombinant Human TMED6 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TMED6-16879M | Recombinant Mouse TMED6 Protein | +Inquiry |
Tmed6-6462M | Recombinant Mouse Tmed6 Protein, Myc/DDK-tagged | +Inquiry |
TMED6-5435C | Recombinant Chicken TMED6 | +Inquiry |
TMED6-9270M | Recombinant Mouse TMED6 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMED6-1023HCL | Recombinant Human TMED6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TMED6 Products
Required fields are marked with *
My Review for All TMED6 Products
Required fields are marked with *
0
Inquiry Basket