Recombinant Human TMED6 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: TMED6-4148H
• Product Overview: TMED6 MS Standard C13 and N15-labeled recombinant protein (NP_653277) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: TMED6 (Transmembrane P24 Trafficking Protein 6) is a Protein Coding gene. An important paralog of this gene is ENSG00000259900.
• Molecular Mass: 27.6 kDa
• AA Sequence: MSPLLFGAGLVVLNLVTSARSQKTEPLSGSGDQPLFRGADRYDFAIMIPPGGTECFWQFAHQTGYFYFSCEVQRTVGMSHDRHVAATAHNPQGFLIDTSQGVRGQINFSTQETGFYQLCLSNQHNHFGSVQVYLNFGVFYEGPETDHKQKERKQLNDTLDAIEDGTQKVQNNIFHMWRYYNFARMRKMADFFLIQSNYNYVNWWSTAQSLVIILSGILQLYFLKRLFNVPTTTDTKKPRCTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: TMED6 transmembrane p24 trafficking protein 6 [ Homo sapiens (human) ]
• Official Symbol: TMED6
• Synonyms: TMED6; transmembrane p24 trafficking protein 6; p24g5; PRO34237; SPLL9146; transmembrane emp24 domain-containing protein 6; p24 family protein gamma-5; p24gamma5; transmembrane emp24 protein transport domain containing 6
• Gene ID: 146456
• mRNA Refseq: NM_144676
• Protein Refseq: NP_653277
• UniProt ID: Q8WW62