Recombinant Human TM4SF19 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: TM4SF19-1031H
• Product Overview: TM4SF19 MS Standard C13 and N15-labeled recombinant protein (NP_612470) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: The protein encoded by this gene is a member of the four-transmembrane L6 superfamily. Members of this family function in various cellular processes including cell proliferation, motility, and adhesion via their interactions with integrins. In human brain tissue, this gene is expressed at high levels in the parietal lobe, occipital lobe, hippocampus, pons, white matter, corpus callosum, and cerebellum. Alternative splicing results in multiple transcript variants encoding different isoforms.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 22.3 kDa
• AA Sequence: MVSSPCTPASSRTCSRILGLSLGTAALFAAGANVALLLPNWDVTYLLRGLLGRHAMLGTGLWGGGLMVLTAAILISLMGWRYGCFSKSGLCRSVLTALLSGGLALLGALICFVTSGVALKDGPFCMFDVSSFNQTQAWKYGYPFKDLHSRNYLYDRSLWNSVCLEPSAAVVWHVSLFSALLCISLLQLLLVVVHVINSLLGLFCSLCEKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: TM4SF19 transmembrane 4 L six family member 19 [ Homo sapiens (human) ]
• Official Symbol: TM4SF19
• Synonyms: TM4SF19; transmembrane 4 L six family member 19; OCTM4; transmembrane 4 L6 family member 19; osteoclast maturation-associated gene 4 protein; tetraspan membrane protein OCTM4
• Gene ID: 116211
• mRNA Refseq: NM_138461
• Protein Refseq: NP_612470
• UniProt ID: Q96DZ7