Recombinant Human TLR5 protein, His-tagged

• Cat.No.: TLR5-903H
• Product Overview: Recombinant Human TLR5(C-198aa) fused with His tag at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 198 a.a.
• Form: 1M PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, pH8.0 ), added with 300 mM Imidazole and 0.7% sarcosyl, 15% glycerol.
• AA Sequence: TKFRGFCFICYKTAQRLVFKDHPQGTEPDMYKYDAYLCFSSKDFTWVQNALLKHLDTQYSDQNRFNLCFEERDFV PGENRIANIQDAIWNSRKIVCLVSRHFLRDGWCLEAFSYAQGRCLSDLNSALIMVVVGSLSQYQLMKHQSIRGFV QKQQYLRWPEDLQDVGWFLHKLSQQILKKEKEKKKDNNIPLQTVATIS
• Storage: Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months. Avoid freeze thaw cycles.
• Shipping: The product is shipped with ice packs. Upon receipt, store it immediately at -20 centigrade to -80 centigrade.

Gene Information

• Gene Name: TLR5 toll-like receptor 5 [ Homo sapiens ]
• Official Symbol: TLR5
• Synonyms: TLR5; toll-like receptor 5; FLJ10052; MGC126430; MGC126431; SLEB1; TIL3; Toll/interleukin 1 receptor like protein 3; toll/interleukin-1 receptor-like protein 3
• Gene ID: 7100
• mRNA Refseq: NM_003268
• Protein Refseq: NP_003259
• MIM: 603031
• UniProt ID: O60602
• Chromosome Location: 1q32.3-q42
• Pathway: Immune System, organism-specific biosystem; Innate Immune System, organism-specific biosystem; Legionellosis, organism-specific biosystem; Legionellosis, conserved biosystem; MyD88 cascade initiated on plasma membrane, organism-specific biosystem; Pathogenic Escherichia coli infection, organism-specific biosystem; Pathogenic Escherichia coli infection, conserved biosystem
• Function: interleukin-1 receptor binding; receptor activity