Recombinant Human TLR2 protein, GST-tagged

• Cat.No.: TLR2-30423TH
• Product Overview: Recombinant Human TLR2(201 a.a. - 300 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• ProteinLength: 201-300 a.a.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 36.63 kDa
• AA Sequence: SHLILHMKQHILLLEIFVDVTSSVECLELRDTDLDTFHFSELSTGETNSLIKKFTFRNVKITDESLFQVMKLLNQISGLLELEFDDCTLNGVGNFRASDN
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: TLR2 toll-like receptor 2 [ Homo sapiens ]
• Official Symbol: TLR2
• Synonyms: TLR2; toll-like receptor 2; CD282; TIL4; toll/interleukin 1 receptor-like 4; toll/interleukin-1 receptor-like protein 4
• Gene ID: 7097
• mRNA Refseq: NM_003264
• Protein Refseq: NP_003255
• MIM: 603028
• UniProt ID: O60603
• Chromosome Location: 4q32
• Pathway: Activated TLR4 signalling, organism-specific biosystem; Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem; Beta defensins, organism-specific biosystem; Chagas disease (American trypanosomiasis), organism-specific biosystem; Chagas disease (American trypanosomiasis), conserved biosystem; Defensins, organism-specific biosystem
• Function: Gram-positive bacterial cell surface binding; lipopolysaccharide receptor activity; pattern recognition receptor activity; peptidoglycan binding; protein binding; protein heterodimerization activity; receptor activity; transmembrane signaling receptor activity; triacyl lipopeptide binding