Recombinant Human TKTL2 Protein, GST-tagged

• Cat.No.: TKTL2-2646H
• Product Overview: Human DKFZP434L1717 partial ORF ( NP_115512, 59 a.a. - 120 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: TKTL2 (Transketolase Like 2) is a Protein Coding gene. Among its related pathways are Carbon metabolism and Metabolism. GO annotations related to this gene include oxidoreductase activity, acting on the aldehyde or oxo group of donors, disulfide as acceptor and transketolase activity. An important paralog of this gene is TKTL1.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 32.56 kDa
• AA Sequence: YKQTDPEHPDNDRFILSRGHAAPILYAAWVEVGDISESDLLNLRKLHSDLERHPTPRLPFVD
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: TKTL2 transketolase-like 2 [ Homo sapiens ]
• Official Symbol: TKTL2
• Synonyms: TKTL2; transketolase-like 2; transketolase-like protein 2; DKFZP434L1717; FLJ32975; similar to transketolase; DKFZp434L1717
• Gene ID: 84076
• mRNA Refseq: NM_032136
• Protein Refseq: NP_115512
• UniProt ID: Q9H0I9