Recombinant Human TIMP2 Protein, His-tagged

• Cat.No.: TIMP2-603H
• Product Overview: Recombinant Human TIMP2 fused with His tag at C-terminal was expressed in HEK293 cells.

Specification

• Description: This gene is a member of the TIMP gene family. The proteins encoded by this gene family are natural inhibitors of the matrix metalloproteinases, a group of peptidases involved in degradation of the extracellular matrix. In addition to an inhibitory role against metalloproteinases, the encoded protein has a unique role among TIMP family members in its ability to directly suppress the proliferation of endothelial cells. As a result, the encoded protein may be critical to the maintenance of tissue homeostasis by suppressing the proliferation of quiescent tissues in response to angiogenic factors, and by inhibiting protease activity in tissues undergoing remodelling of the extracellular matrix.
• Source: HEK293 cells
• Species: Human
• Tag: His
• Form: Lyophilized from a 0.2 µM filtered solution of 20mM PB, 150mM NaCl, pH 7.2
• Molecular Mass: 22.79kD
• AA Sequence: CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDPVDHHHHHH
• Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Gene Information

• Gene Name: TIMP2 TIMP metallopeptidase inhibitor 2 [ Homo sapiens ]
• Official Symbol: TIMP2
• Synonyms: TIMP2; TIMP metallopeptidase inhibitor 2; tissue inhibitor of metalloproteinase 2; metalloproteinase inhibitor 2; CSC 21K; TIMP-2; tissue inhibitor of metalloproteinases 2; CSC-21K
• Gene ID: 7077
• mRNA Refseq: NM_003255
• Protein Refseq: NP_003246
• MIM: 188825
• UniProt ID: P16035