Recombinant Human TIMM13 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: TIMM13-4618H
• Product Overview: TIMM13 MS Standard C13 and N15-labeled recombinant protein (NP_036590) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: This gene encodes a member of the evolutionarily conserved TIMM (translocase of inner mitochondrial membrane) family of proteins that function as chaperones in the import of proteins from the cytoplasm into the mitochondrial inner membrane. Proteins of this family play a role in collecting substrate proteins from the translocase of the outer mitochondrial membrane (TOM) complex and delivering them to either the sorting and assembly machinery in the outer mitochondrial membrane (SAM) complex or the TIMM22 complex in the inner mitochondrial membrane. The encoded protein and the translocase of mitochondrial inner membrane 8a protein form a 70 kDa complex in the intermembrane space.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 10.5 kDa
• AA Sequence: MEGGFGSDFGGSGSGKLDPGLIMEQVKVQIAVANAQELLQRMTDKCFRKCIGKPGGSLDNSEQKCIAMCMDRYMDAWNTVSRAYNSRLQRERANMTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: TIMM13 translocase of inner mitochondrial membrane 13 [ Homo sapiens (human) ]
• Official Symbol: TIMM13
• Synonyms: TIMM13; translocase of inner mitochondrial membrane 13 homolog (yeast); TIMM13B, translocase of inner mitochondrial membrane 13 (yeast) homolog B; mitochondrial import inner membrane translocase subunit Tim13; Tim13; mitochondrial import inner membrane translocase subunit Tim13B; ppv1; TIM13; TIM13B; TIMM13A; TIMM13B
• Gene ID: 26517
• mRNA Refseq: NM_012458
• Protein Refseq: NP_036590
• MIM: 607383
• UniProt ID: Q9Y5L4