Recombinant Full Length Human TIMM13 Protein, GST-tagged
Cat.No. : | TIMM13-6803HF |
Product Overview : | Recombinant Human TIMM13 Full-Length ORF Protein (1-95 aa) is produced by Wheat Germ (in vitro) expression system. This protein is fused with a GST tag at the N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Description : | This gene encodes a translocase with similarity to yeast mitochondrial proteins that are involved in the import of metabolite transporters from the cytoplasm and into the mitochondrial inner membrane. The encoded protein and the TIMM8a protein form a 70 kDa complex in the intermembrane space. This gene is in a head-to-tail orientation with the gene for lamin B2. |
Source : | In Vitro Cell Free System |
Species : | Human |
Tag : | GST |
Form : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 36.19 kDa |
Protein length : | 95 amino acids |
AA Sequence : | MEGGFGSDFGGSGSGKLDPGLIMEQVKVQIAVANAQELLQRMTDKCFRKCIGKPGGSLDNSEQKCIAMCMDRYMDAWNTVSRAYNSRLQRERANM |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | TIMM13 translocase of inner mitochondrial membrane 13 homolog (yeast) [ Homo sapiens ] |
Official Symbol | TIMM13 |
Synonyms | TIMM13; Tim13; ppv1; TIM13; TIM13B; TIMM13A; TIMM13B; |
Gene ID | 26517 |
mRNA Refseq | NM_012458 |
Protein Refseq | NP_036590 |
MIM | 607383 |
UniProt ID | Q9Y5L4 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All TIMM13 Products
Required fields are marked with *
My Review for All TIMM13 Products
Required fields are marked with *
0
Inquiry Basket