Recombinant Human TICAM1 protein, GST-tagged

• Cat.No.: TICAM1-301439H
• Product Overview: Recombinant Human TICAM1 (1-143 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• ProteinLength: Met1-Arg143
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: MACTGPSLPSAFDILGAAGQDKLLYLKHKLKTPRPGCQGQDLLHAMVLLKLGQETEARISLEALKADAVARLVARQWAGVDSTEDPEEPPDVSWAVARLYHLLAEEKLCPASLRDVAYQEAVRTLSSRDDHRLGELQDEARNR
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: TICAM1 toll-like receptor adaptor molecule 1 [ Homo sapiens ]
• Official Symbol: TICAM1
• Synonyms: TICAM1; toll-like receptor adaptor molecule 1; TIR domain-containing adapter molecule 1; MGC35334; PRVTIRB; TICAM 1; TRIF; putative NF-kappa-B-activating protein 502H; TIR domain containing adaptor inducing interferon-beta; TIR domain-containing adapter protein inducing IFN-beta; proline-rich, vinculin and TIR domain-containing protein B; toll-interleukin-1 receptor domain-containing adapter protein inducing interferon beta; TICAM-1
• Gene ID: 148022
• mRNA Refseq: NM_182919
• Protein Refseq: NP_891549
• MIM: 607601
• UniProt ID: Q8IUC6