Recombinant Human TIAF1 protein, GST-tagged

• Cat.No.: TIAF1-3581H
• Product Overview: Recombinant Human TIAF1 protein(O95411)(1-115aa), fused to N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• ProteinLength: 1-115aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 39.4 kDa
• AA Sequence: MSSPSSPFREQSFLCAAGDAGEESRVQVLKNEVRRGSPVLLGWVEQAYADKCVCGPSAPPAPTPPSLSQRVMCNDLFKVNPFQLQQFRADPSTASLLLCPGGLDHKLNLRGKAWG
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: TIAF1 TGFB1-induced anti-apoptotic factor 1 [ Homo sapiens ]
• Official Symbol: TIAF1
• Synonyms: TIAF1; TGFB1-induced anti-apoptotic factor 1; TGF-beta-1-induced antiapoptotic factor 1; molecule associated with Jak-3 N-terminal; 12 kDa TGF-beta-1-induced antiapoptotic factor; MAJN; SPR210
• Gene ID: 9220
• mRNA Refseq: NM_004740
• Protein Refseq: NP_004731
• MIM: 609517
• UniProt ID: O95411