Recombinant Human thymosin beta 10 Protein, His-tagged
Cat.No. : | TMSB10-01H |
Product Overview : | Recombinant Human TMSB10 Protein (2-44aa) with C-His-tag was expressed E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 2-44aa |
Description : | Predicted to enable actin monomer binding activity. Predicted to be involved in regulation of cell migration and sequestering of actin monomers. Predicted to be located in cytoskeleton. Predicted to be active in cytoplasm. |
Tag : | C-His |
Molecular Mass : | 6 kDa |
AA Sequence : | MADKPDMGEIASFDKAKLKKTETQEKNTLPTKETIEQEKRSEISHHHHHHHHHH |
Endotoxin : | < 1 EU/μg by LAL. |
Purity : | > 90 % by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.5 mg/mL by BCA |
Storage Buffer : | Sterile PBS, pH7.4. |
Gene Name | TMSB10 thymosin beta 10 [Homo sapiens (human)] |
Official Symbol | TMSB10 |
Synonyms | TMSB10; thymosin beta 10; thymosin beta-10; TB10; migration-inducing gene 12; migration-inducing protein 12; MIG12 |
Gene ID | 9168 |
mRNA Refseq | NM_021103 |
Protein Refseq | NP_066926 |
MIM | 188399 |
UniProt ID | P63313 |
◆ Recombinant Proteins | ||
TMSB10-6188R | Recombinant Rat TMSB10 Protein | +Inquiry |
TMSB10-01H | Recombinant Human thymosin beta 10 Protein, His-tagged | +Inquiry |
TMSB10-1185H | Recombinant Human TMSB10 protein, GST-tagged | +Inquiry |
Tmsb10-6529M | Recombinant Mouse Tmsb10 Protein, Myc/DDK-tagged | +Inquiry |
TMSB10-8553H | Recombinant Human TMSB10 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMSB10-906HCL | Recombinant Human TMSB10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TMSB10 Products
Required fields are marked with *
My Review for All TMSB10 Products
Required fields are marked with *
0
Inquiry Basket