Recombinant Human THPO Protein, GMP Grade, Animal-Free

• Cat.No.: THPO-41HG
• Product Overview: GMP Recombinant Human THPO protein with out tag was expressed in E. coli and manufactured using animal-derived component free materials.

Specification

• Species: Human
• Source: E.coli
• Description: TPO is a lineage-specific growth factor produced in the liver, kidney and skeletal muscle. It stimulates the proliferation and maturation of megakaryocytes, and promotes increased circulating levels of platelets in vivo. TPO signals through the c-mpl receptor, and acts as an important regulator of circulating platelets.
• AA Sequence: SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNEL
• Purity: ≥ 98% by SDS-PAGE gel and HPLC analyses.

Gene Information

• Gene Name: THPO thrombopoietin [ Homo sapiens (human) ]
• Official Symbol: THPO
• Synonyms: THPO; thrombopoietin; ML; TPO; MGDF; MKCSF; MPLLG; THCYT1; thrombopoietin; MPL ligand; c-mpl ligand; megakaryocyte colony-stimulating factor; megakaryocyte growth and development factor; megakaryocyte stimulating factor; myeloproliferative leukemia virus oncogene ligand; prepro-thrombopoietin; thrombopoietin nirs
• Gene ID: 7066
• mRNA Refseq: NM_000460
• Protein Refseq: NP_000451
• MIM: 600044
• UniProt ID: P40225