Recombinant Human THOC7 protein, GST-tagged
Cat.No. : | THOC7-30155H |
Product Overview : | Recombinant Human THOC7 (1-204 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Source : | E. coli |
Species : | Human |
Tag : | GST |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Protein length : | Met1-Pro204 |
AA Sequence : | MGAVTDDEVIRKRLLIDGDGAGDDRRINLLVKSFIKWCNSGSQEEGYSQYQRMLSTLSQCEFSMGKTLLVYDMNLREMENYEKIYKEIECSIAGAHEKIAECKKQILQAKRIRKNRQEYDALAKVIQHHPDRHETLKELEALGKELEHLSHIKESVEDKLELRRKQFHVLLSTIHELQQTLENDEKLSEVEEAQEASMETDPKP |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | THOC7 THO complex 7 homolog (Drosophila) [ Homo sapiens ] |
Official Symbol | THOC7 |
Synonyms | THOC7; THO complex 7 homolog (Drosophila); THO complex subunit 7 homolog; FLJ23445; fSAP24; functional spliceosome associated protein 24; Ngg1 interacting factor 3 like 1 binding protein 1; NIF3L1BP1; hTREX30; NIF3L1-binding protein 1; functional spliceosome-associated protein 24; ngg1-interacting factor 3-like protein 1-binding protein 1; |
Gene ID | 80145 |
mRNA Refseq | NM_025075 |
Protein Refseq | NP_079351 |
MIM | 611965 |
UniProt ID | Q6I9Y2 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All THOC7 Products
Required fields are marked with *
My Review for All THOC7 Products
Required fields are marked with *
0
Inquiry Basket