Recombinant Human THOC7 protein, GST-tagged

Cat.No. : THOC7-30155H
Product Overview : Recombinant Human THOC7 (1-204 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Met1-Pro204
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : MGAVTDDEVIRKRLLIDGDGAGDDRRINLLVKSFIKWCNSGSQEEGYSQYQRMLSTLSQCEFSMGKTLLVYDMNLREMENYEKIYKEIECSIAGAHEKIAECKKQILQAKRIRKNRQEYDALAKVIQHHPDRHETLKELEALGKELEHLSHIKESVEDKLELRRKQFHVLLSTIHELQQTLENDEKLSEVEEAQEASMETDPKP
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name THOC7 THO complex 7 homolog (Drosophila) [ Homo sapiens ]
Official Symbol THOC7
Synonyms THOC7; THO complex 7 homolog (Drosophila); THO complex subunit 7 homolog; FLJ23445; fSAP24; functional spliceosome associated protein 24; Ngg1 interacting factor 3 like 1 binding protein 1; NIF3L1BP1; hTREX30; NIF3L1-binding protein 1; functional spliceosome-associated protein 24; ngg1-interacting factor 3-like protein 1-binding protein 1;
Gene ID 80145
mRNA Refseq NM_025075
Protein Refseq NP_079351
MIM 611965
UniProt ID Q6I9Y2

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All THOC7 Products

Required fields are marked with *

My Review for All THOC7 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon