Recombinant Human THOC5 protein, His-tagged

• Cat.No.: THOC5-3354H
• Product Overview: Recombinant Human THOC5 protein(354-683 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 354-683 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: CKDDSVLHLTFYYLMNLNIMTVKAKVTTAMELITPISAGDLLSPDSVLSCLYPGDHGKKTPNPANQYQFDKVGILTLSDYVLELGHPYLWVQKLGGLHFPKEQPQQTVIADHSLSASHMETTMKLLKTRVQSRLALHKQFASLEHGIVPVTSDCQYLFPAKVVSRLVKWVTIAHEDYMELHFTKDIVDAGLAGDTNLYYMALIERGTAKLQAAVVLNPGYSSIPPIFQLCLNWKGEKTNSNDDNIRAMEGEVNVCYKELCGPWPSHQLLTNQLQRLCVLLDVYLETESHDDSVEGPKEFPQEKMCLRLFRGPSRMKPFKYNHPQGFFSHR
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: THOC5 THO complex 5 [ Homo sapiens ]
• Official Symbol: THOC5
• Synonyms: THOC5; THO complex 5; C22orf19, chromosome 22 open reading frame 19; THO complex subunit 5 homolog; Fmip; fSAP79; functional spliceosome associated protein 79; KIAA0983; PK1.3; PP39.2; hTREX90; placental protein 39.2; Fms-interacting protein; NF2/meningioma region protein pK1.3; functional spliceosome-associated protein 79; C22orf19
• Gene ID: 8563
• mRNA Refseq: NM_001002877
• Protein Refseq: NP_001002877
• MIM: 612733
• UniProt ID: Q13769