Recombinant Human THAP4, His-tagged
Cat.No. : | THAP4-31144TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 326-577 of Human THAP4 with N terminal His tag, 35kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | 326-577 a.a. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 59 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MSINEVILSASGACKLIDSLHSYCFSSRQNKSQVCCLREQ VEKKNGELKSLRQRVSRSDSQVRKLQEKLDELRRVSVP YPSSLLSPSREPPKMNPVVEPLSWMLGTWLSDPPGAGT YPTLQPFQYLEEVHISHVGQPMLNFSFNSFHPDTRKPMHRECGFIRLKPDTNKVAFVSAQNTGVVEVEEGEVNGQELC IASHSIARISFAKEPHVEQITRKFRLNSEGKLEQTVSM ATTTQPMTQHLHVTYKKVTP |
Sequence Similarities : | Contains 1 THAP-type zinc finger. |
Gene Name | THAP4 THAP domain containing 4 [ Homo sapiens ] |
Official Symbol | THAP4 |
Synonyms | THAP4; THAP domain containing 4; THAP domain-containing protein 4; CGI 36; |
Gene ID | 51078 |
mRNA Refseq | NM_015963 |
Protein Refseq | NP_057047 |
MIM | 612533 |
Uniprot ID | Q8WY91 |
Chromosome Location | 2q37.3 |
Function | DNA binding; metal ion binding; |
◆ Recombinant Proteins | ||
AVIL-1137HF | Recombinant Full Length Human AVIL Protein, GST-tagged | +Inquiry |
MYO1C-8037H | Recombinant Human MYO1C protein, His & GST-tagged | +Inquiry |
DEFA2-4446M | Recombinant Mouse DEFA2 Protein | +Inquiry |
POT1-2787H | Recombinant Full Length Human POT1 Protein, Isoform 1, GST-tagged | +Inquiry |
FLCN-937H | Recombinant Human FLCN Protein, His&SUMO-tagged | +Inquiry |
◆ Native Proteins | ||
THBD-306R | Active Native Rabbit Lung Thrombomodulin | +Inquiry |
CALMODULIN-185B | Active Native Bovine Calmodulin | +Inquiry |
F10-290M | Active Native Mouse Factor X | +Inquiry |
Vtn -70R | Native Rat multimeric vitronectin | +Inquiry |
eCG-01E | Active Native Equine Gonadotropin protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TRA2B-827HCL | Recombinant Human TRA2B 293 Cell Lysate | +Inquiry |
LDLRAD2-4785HCL | Recombinant Human LDLRAD2 293 Cell Lysate | +Inquiry |
UIMC1-506HCL | Recombinant Human UIMC1 293 Cell Lysate | +Inquiry |
APPBP2-100HCL | Recombinant Human APPBP2 cell lysate | +Inquiry |
IRAK2-5171HCL | Recombinant Human IRAK2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All THAP4 Products
Required fields are marked with *
My Review for All THAP4 Products
Required fields are marked with *
0
Inquiry Basket