Recombinant Human THAP1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: THAP1-3251H
• Product Overview: THAP1 MS Standard C13 and N15-labeled recombinant protein (NP_060575) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: The protein encoded by this gene contains a THAP domain, a conserved DNA-binding domain. This protein colocalizes with the apoptosis response protein PAWR/PAR-4 in promyelocytic leukemia (PML) nuclear bodies, and functions as a proapoptotic factor that links PAWR to PML nuclear bodies. Alternatively spliced transcript variants encoding distinct isoforms have been observed.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 24.9 kDa
• AA Sequence: MVQSCSAYGCKNRYDKDKPVSFHKFPLTRPSLCKEWEAAVRRKNFKPTKYSSICSEHFTPDCFKRECNNKLLKENAVPTIFLCTEPHDKKEDLLEPQEQLPPPPLPPPVSQVDAAIGLLMPPLQTPVNLSVFCDHNYTVEDTMHQRKRIHQLEQQVEKLRKKLKTAQQRCRRQERQLEKLKEVVHFQKEKDDVSERGYVILPNDYFEIVEVPATRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: THAP1 THAP domain containing 1 [ Homo sapiens (human) ]
• Official Symbol: THAP1
• Synonyms: THAP1; THAP domain containing, apoptosis associated protein 1; dystonia 6, torsion (autosomal dominant), DYT6; 4833431A01Rik; FLJ10477
• Gene ID: 55145
• mRNA Refseq: NM_018105
• Protein Refseq: NP_060575
• MIM: 609520
• UniProt ID: Q9NVV9