Recombinant Human TGIF2LX protein, His-SUMO-tagged
Cat.No. : | TGIF2LX-4615H |
Product Overview : | Recombinant Human TGIF2LX protein(Q8IUE1)(1-241aa), fused to N-terminal His-SUMO tag, was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-241aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 42.7 kDa |
AA Sequence : | MEAAADGPAETQSPVEKDSPAKTQSPAQDTSIMSRNNADTGRVLALPEHKKKRKGNLPAESVKILRDWMYKHRFKAYPSEEEKQMLSEKTNLSLLQISNWFINARRRILPDMLQQRRNDPIIGHKTGKDAHATHLQSTEASVPAKSGPSGPDNVQSLPLWPLPKGQMSREKQPDPESAPSQKLTGIAQPKKKVKVSVTSPSSPELVSPEEHADFSSFLLLVDAAVQRAAELELEKKQEPNP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | TGIF2LX TGFB-induced factor homeobox 2-like, X-linked [ Homo sapiens ] |
Official Symbol | TGIF2LX |
Synonyms | TGIF2LX; TGFB-induced factor homeobox 2-like, X-linked; TGFB induced factor 2 like, X linked; homeobox protein TGIF2LX; TGIF-like on the X; TGFB-induced factor 2-like, X-linked; TGFB-induced factor 2-like protein, X-linked; TGF-beta-induced transcription factor 2-like protein; TGIFLX; MGC34726; |
Gene ID | 90316 |
mRNA Refseq | NM_138960 |
Protein Refseq | NP_620410 |
MIM | 300411 |
UniProt ID | Q8IUE1 |
◆ Recombinant Proteins | ||
TGIF2LX-4615H | Recombinant Human TGIF2LX protein, His-SUMO-tagged | +Inquiry |
TGIF2LX-506H | Recombinant Human TGFB-induced factor homeobox 2-like, X-linked, His-tagged | +Inquiry |
TGIF2LX-3626H | Recombinant Human TGIF2LX protein, GST-tagged | +Inquiry |
TGIF2LX-4505R | Recombinant Rhesus Macaque TGIF2LX Protein, His (Fc)-Avi-tagged | +Inquiry |
TGIF2LX-4691R | Recombinant Rhesus monkey TGIF2LX Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TGIF2LX-1112HCL | Recombinant Human TGIF2LX 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TGIF2LX Products
Required fields are marked with *
My Review for All TGIF2LX Products
Required fields are marked with *
0
Inquiry Basket