Recombinant Human TGIF2LX protein, His-SUMO-tagged

• Cat.No.: TGIF2LX-4615H
• Product Overview: Recombinant Human TGIF2LX protein(Q8IUE1)(1-241aa), fused to N-terminal His-SUMO tag, was expressed in E. coli

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• ProteinLength: 1-241aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 42.7 kDa
• AA Sequence: MEAAADGPAETQSPVEKDSPAKTQSPAQDTSIMSRNNADTGRVLALPEHKKKRKGNLPAESVKILRDWMYKHRFKAYPSEEEKQMLSEKTNLSLLQISNWFINARRRILPDMLQQRRNDPIIGHKTGKDAHATHLQSTEASVPAKSGPSGPDNVQSLPLWPLPKGQMSREKQPDPESAPSQKLTGIAQPKKKVKVSVTSPSSPELVSPEEHADFSSFLLLVDAAVQRAAELELEKKQEPNP
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: TGIF2LX TGFB-induced factor homeobox 2-like, X-linked [ Homo sapiens ]
• Official Symbol: TGIF2LX
• Synonyms: TGIF2LX; TGFB-induced factor homeobox 2-like, X-linked; TGFB induced factor 2 like, X linked; homeobox protein TGIF2LX; TGIF-like on the X; TGFB-induced factor 2-like, X-linked; TGFB-induced factor 2-like protein, X-linked; TGF-beta-induced transcription factor 2-like protein; TGIFLX; MGC34726
• Gene ID: 90316
• mRNA Refseq: NM_138960
• Protein Refseq: NP_620410
• MIM: 300411
• UniProt ID: Q8IUE1