Recombinant Human TGFB1 Protein, Fc-tagged
Cat.No. : | TGFB-13H |
Product Overview : | Recombinant Human TGFB1 Protein with Fc tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Fc |
Description : | This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate a latency-associated peptide (LAP) and a mature peptide, and is found in either a latent form composed of a mature peptide homodimer, a LAP homodimer, and a latent TGF-beta binding protein, or in an active form consisting solely of the mature peptide homodimer. The mature peptide may also form heterodimers with other TGFB family members. This encoded protein regulates cell proliferation, differentiation and growth, and can modulate expression and activation of other growth factors including interferon gamma and tumor necrosis factor alpha. This gene is frequently upregulated in tumor cells, and mutations in this gene result in Camurati-Engelmann disease. |
Form : | Liquid |
AA Sequence : | ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCSLEVLFQGGGGGSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK* |
Purity : | > 90% determined by SDS-PAGE (Reduced) |
Storage : | Store at -20 to -80 centigrade. |
Storage Buffer : | PBS, pH 6.8 |
Gene Name | TGFB1 transforming growth factor beta 1 [ Homo sapiens (human) ] |
Official Symbol | TGFB1 |
Synonyms | TGFB1; transforming growth factor beta 1; CED; LAP; DPD1; TGFB; IBDIMDE; TGFbeta; TGF-beta1; transforming growth factor beta-1 proprotein; TGF-beta-1; latency-associated peptide; prepro-transforming growth factor beta-1; transforming growth factor beta1 |
Gene ID | 7040 |
mRNA Refseq | NM_000660 |
Protein Refseq | NP_000651 |
MIM | 190180 |
UniProt ID | P01137 |
◆ Recombinant Proteins | ||
TGFB1-335H | Recombinant Human TGFB1 protein (Met1-Arg278), His-tagged | +Inquiry |
TGFB1-119H | Recombinant Human Transforming Growth Factor, Beta 1, GST-tagged | +Inquiry |
TGFB1-158H | Recombinant Human TGFB1 Protein, Leu30-Arg278, C33S, N-His-Avi tagged, Biotinylated | +Inquiry |
TGFB1-3209H | Recombinant Human TGFB1, His-tagged | +Inquiry |
TGFB1-429H | Recombinant Human TGFB1 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
TGFB1-21H | Active Native Human TGF- β1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
TGFB1-001MCL | Recombinant Mouse TGFB1 cell lysate | +Inquiry |
TGFB1-001HCL | Recombinant Human TGFB1 cell lysate | +Inquiry |
TGFB1-2662HCL | Recombinant Human TGFB1 cell lysate | +Inquiry |
TGFB1-803RCL | Recombinant Rat TGFB1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TGFB1 Products
Required fields are marked with *
My Review for All TGFB1 Products
Required fields are marked with *
0
Inquiry Basket