Recombinant Human TGFB1 Protein, Fc-tagged

• Cat.No.: TGFB1-04H
• Product Overview: Recombinant Human TGFB1 Protein, fused to Fc-tag was expressed in HEK293T cells.

Specification

• Description: This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate a latency-associated peptide (LAP) and a mature peptide, and is found in either a latent form composed of a mature peptide homodimer, a LAP homodimer, and a latent TGF-beta binding protein, or in an active form consisting solely of the mature peptide homodimer. The mature peptide may also form heterodimers with other TGFB family members. This encoded protein regulates cell proliferation, differentiation and growth, and can modulate expression and activation of other growth factors including interferon gamma and tumor necrosis factor alpha. This gene is frequently upregulated in tumor cells, and mutations in this gene result in Camurati-Engelmann disease.
• Source: HEK293
• Species: Human
• Tag: Fc
• Form: Liquid
• AA Sequence: ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCSLEVLFQGGGGGSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK*
• Purity: >90% determined by SDS-PAGE (Reduced).
• Storage: Store at -20 centigrade to -80 centigrade.
• Storage Buffer: PBS, pH 6.8

Gene Information

• Gene Name: TGFB1 transforming growth factor beta 1 [ Homo sapiens (human) ]
• Official Symbol: TGFB1
• Synonyms: CED; LAP; DPD1; TGFB; IBDIMDE; TGFbeta; TGF-beta1
• Gene ID: 7040
• mRNA Refseq: NM_000660.7
• Protein Refseq: NP_000651.3
• MIM: 190180
• UniProt ID: P01137