Recombinant Human TG, GST-tagged

• Cat.No.: TG-8266H
• Product Overview: Human TG partial ORF ( NP_003226, 2671 a.a. - 2768 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: Thyroglobulin (Tg) is a glycoprotein homodimer produced predominantly by the thryroid gland. It acts as a substrate for the synthesis of thyroxine and triiodothyronine as well as the storage of the inactive forms of thyroid hormone and iodine. Thyroglobulin is secreted from the endoplasmic reticulum to its site of iodination, and subsequent thyroxine biosynthesis, in the follicular lumen. Mutations in this gene cause thyroid dyshormonogenesis, manifested as goiter, and are associated with moderate to severe congenital hypothyroidism. Polymorphisms in this gene are associated with susceptibility to autoimmune thyroid diseases (AITD) such as Graves disease and Hashimoto thryoiditis.
• Source: Wheat germ
• Species: Human
• Tag: GST
• Molecular Mass: 36.52 kDa
• AA Sequence: PYEFSRKVPTFATPWPDFVPRAGGENYKEFSELLPNRQGLKKADCSFWS KYISSLKTSADGAKGGQSAESEEEE LTAGSGLREDLLSLQEPGSKTYSK
• Applications: ELISA; WB-Re; AP; Array
• Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: TG thyroglobulin [ Homo sapiens (human) ]
• Official Symbol: TG
• Synonyms: TG; TGN; AITD3; thyroglobulin
• Gene ID: 7038
• mRNA Refseq: NM_003235
• Protein Refseq: NP_003226
• MIM: 188450
• UniProt ID: P01266
• Chromosome Location: 8q24
• Pathway: Autoimmune thyroid disease; Thyroid hormone synthesis
• Function: NOT carboxylesterase activity; hormone activity; NOT neurexin family protein binding