Recombinant Human TFPI Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | TFPI-5798H |
Product Overview : | TFPI MS Standard C13 and N15-labeled recombinant protein (NP_001027452) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a Kunitz-type serine protease inhibitor that regulates the tissue factor (TF)-dependent pathway of blood coagulation. The coagulation process initiates with the formation of a factor VIIa-TF complex, which proteolytically activates additional proteases (factors IX and X) and ultimately leads to the formation of a fibrin clot. The product of this gene inhibits the activated factor X and VIIa-TF proteases in an autoregulatory loop. Inhibition of the encoded protein restores hemostasis in animal models of hemophilia. This gene encodes multiple protein isoforms that differ in their inhibitory activity, specificity and cellular localization. |
Molecular Mass : | 28.7 kDa |
AA Sequence : | MIYTMKKVHALWASVCLLLNLAPAPLNADSEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVNNSLTPQSTKVPSLFVTKEGTNDGWKNAAHIYQVFLNAFCIHASMFFLGLDSISCLCTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | TFPI tissue factor pathway inhibitor [ Homo sapiens (human) ] |
Official Symbol | TFPI |
Synonyms | TFPI; tissue factor pathway inhibitor (lipoprotein-associated coagulation inhibitor); LACI; tissue factor pathway inhibitor; EPI; extrinsic pathway inhibitor; TFI; TFPI1; anti-convertin; |
Gene ID | 7035 |
mRNA Refseq | NM_001032281 |
Protein Refseq | NP_001027452 |
MIM | 152310 |
UniProt ID | P10646 |
◆ Recombinant Proteins | ||
TFPI-2145H | Active Recombinant Human TFPI protein, His-tagged | +Inquiry |
TFPI-107H | Recombinant Human TFPI protein, His/GST-tagged | +Inquiry |
TFPI-6424H | Recombinant Human TFPI Protein (Asp29-Phe209), N-His tagged | +Inquiry |
TFPI-2260R | Recombinant Rabbit TFPI protein, His-tagged | +Inquiry |
TFPI-106H | Recombinant Human TFPI protein, His/GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TFPI-2843MCL | Recombinant Mouse TFPI cell lysate | +Inquiry |
TFPI-2746HCL | Recombinant Human TFPI cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TFPI Products
Required fields are marked with *
My Review for All TFPI Products
Required fields are marked with *
0
Inquiry Basket