Recombinant Human TFF1 protein, His-tagged

• Cat.No.: TFF1-204H
• Product Overview: Recombinant human TFF1 cDNA (25 – 84aa) fused with Alpha-Fetal Protein N-terminal domain (AFPn)-His-TEV cleavage site (219aa) at N-terminal was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
• AA Sequence: MTLHRNEYGIASILDSYQCTAEISLADLATIFFAQFVQEATYKEVSKMVKDALTAIEKPTGDEQSSGCLENQLPA FLEELCHEKEILEKYGHSDCCSQSEEGRHNCFLAHKKPTPASIPLFQVPEPVTSCEAYEEDRETFMNKFIYEIAR RHPFLYAPTILLWAARYDKIIPSCCKAENAVECFQTKAATVTKELRESSGGSHHHHHHGSENLYFQGEFEAQTET CTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPEEECEF
• Purity: >90% by SDS-PAGE.
• Storage: Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days.
• Protein length: 25-84 a.a.

Gene Information

• Gene Name: TFF1 trefoil factor 1 [ Homo sapiens ]
• Official Symbol: TFF1
• Synonyms: TFF1; trefoil factor 1; BCEI, breast cancer, estrogen inducible sequence expressed in; D21S21; HP1.A; HPS2; pNR 2; pS2; protein pS2; polypeptide P1.A; BCEI; pNR-2
• Gene ID: 7031
• mRNA Refseq: NM_003225
• Protein Refseq: NP_003216
• MIM: 113710
• UniProt ID: P04155
• Chromosome Location: 21q22.3
• Pathway: FOXA1 transcription factor network, organism-specific biosystem
• Function: growth factor activity; protein binding