Recombinant Human TFF1 protein, His-tagged

Cat.No. : TFF1-204H
Product Overview : Recombinant human TFF1 cDNA (25 – 84aa) fused with Alpha-Fetal Protein N-terminal domain (AFPn)-His-TEV cleavage site (219aa) at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 25-84 a.a.
Form : 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence : MTLHRNEYGIASILDSYQCTAEISLADLATIFFAQFVQEATYKEVSKMVKDALTAIEKPTGDEQSSGCLENQLPA FLEELCHEKEILEKYGHSDCCSQSEEGRHNCFLAHKKPTPASIPLFQVPEPVTSCEAYEEDRETFMNKFIYEIAR RHPFLYAPTILLWAARYDKIIPSCCKAENAVECFQTKAATVTKELRESSGGSHHHHHHGSENLYFQGEFEAQTET CTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPEEECEF
Purity : >90% by SDS-PAGE.
Storage : Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days.
Gene Name TFF1 trefoil factor 1 [ Homo sapiens ]
Official Symbol TFF1
Synonyms TFF1; trefoil factor 1; BCEI, breast cancer, estrogen inducible sequence expressed in; D21S21; HP1.A; HPS2; pNR 2; pS2; protein pS2; polypeptide P1.A; BCEI; pNR-2;
Gene ID 7031
mRNA Refseq NM_003225
Protein Refseq NP_003216
MIM 113710
UniProt ID P04155
Chromosome Location 21q22.3
Pathway FOXA1 transcription factor network, organism-specific biosystem;
Function growth factor activity; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All TFF1 Products

Required fields are marked with *

My Review for All TFF1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon