Recombinant Human TFEB protein, His-tagged

• Cat.No.: TFEB-6592H
• Product Overview: Recombinant Human TFEB protein(P19484)(Glu221-Pro380), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: Glu221-Pro380
• Tag: C-His
• Form: Phosphate buffered saline.
• Molecular Mass: 21 kDa
• Storage: Store at -20°C to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: ELTDAESRALAKERQKKDNHNLIERRRRFNINDRIKELGMLIPKANDLDVRWNKGTILKASVDYIRRMQKDLQKSRELENHSRRLEMTNKQLWLRIQELEMQARVHGLPTTSPSGMNMAELAQQVVKQELPSEEGPGEALMLGAEVPDPEPLPALPPQAP

Gene Information

• Gene Name: TFEB transcription factor EB [ Homo sapiens ]
• Official Symbol: TFEB
• Synonyms: TFEB; transcription factor EB; bHLHe35; TCFEB; T-cell transcription factor EB; class E basic helix-loop-helix protein 35; BHLHE35; ALPHATFEB
• Gene ID: 7942
• mRNA Refseq: NM_001167827
• Protein Refseq: NP_001161299
• MIM: 600744
• UniProt ID: P19484