Recombinant Human TFDP1 protein, His-tagged

• Cat.No.: TFDP1-4039H
• Product Overview: Recombinant Human TFDP1 protein(101-249 aa), fused with His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• ProteinLength: 101-249 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: SAGKRNRKGEKNGKGLRHFSMKVCEKVQRKGTTSYNEVADELVAEFSAADNHILPNESAYDQKNIRRRVYDALNVLMAMNIISKEKKEIKWIGLPTNSAQECQNLEVERQRRLERIKQKQSQLQELILQQIAFKNLVQRNRHAEQQASR
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.

Gene Information

• Gene Name: TFDP1 transcription factor Dp-1 [ Homo sapiens ]
• Official Symbol: TFDP1
• Synonyms: TFDP1; transcription factor Dp-1; Dp 1; DP1; DRTF1; DRTF1-polypeptide 1; E2F dimerization partner 1; E2F-related transcription factor; Dp-1
• Gene ID: 7027
• mRNA Refseq: NM_007111
• Protein Refseq: NP_009042
• MIM: 189902
• UniProt ID: Q14186