Recombinant Human TFDP1 protein, His-tagged
Cat.No. : | TFDP1-4039H |
Product Overview : | Recombinant Human TFDP1 protein(101-249 aa), fused with His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 101-249 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | SAGKRNRKGEKNGKGLRHFSMKVCEKVQRKGTTSYNEVADELVAEFSAADNHILPNESAYDQKNIRRRVYDALNVLMAMNIISKEKKEIKWIGLPTNSAQECQNLEVERQRRLERIKQKQSQLQELILQQIAFKNLVQRNRHAEQQASR |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
Gene Name | TFDP1 transcription factor Dp-1 [ Homo sapiens ] |
Official Symbol | TFDP1 |
Synonyms | TFDP1; transcription factor Dp-1; Dp 1; DP1; DRTF1; DRTF1-polypeptide 1; E2F dimerization partner 1; E2F-related transcription factor; Dp-1; |
Gene ID | 7027 |
mRNA Refseq | NM_007111 |
Protein Refseq | NP_009042 |
MIM | 189902 |
UniProt ID | Q14186 |
◆ Recombinant Proteins | ||
TFDP1-4039H | Recombinant Human TFDP1 protein, His-tagged | +Inquiry |
TFDP1-1411H | Recombinant Human TFDP1 protein, His & GST-tagged | +Inquiry |
Tfdp1-6377M | Recombinant Mouse Tfdp1 Protein, Myc/DDK-tagged | +Inquiry |
TFDP1-1412H | Recombinant Human TFDP1 protein, His-GST-tagged | +Inquiry |
TFDP1-4040H | Recombinant Human TFDP1 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TFDP1-1132HCL | Recombinant Human TFDP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TFDP1 Products
Required fields are marked with *
My Review for All TFDP1 Products
Required fields are marked with *
0
Inquiry Basket