Recombinant Human TEX35 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: TEX35-6502H
• Product Overview: C1orf49 MS Standard C13 and N15-labeled recombinant protein (NP_115502) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: TEX35 (Testis Expressed 35) is a Protein Coding gene.
• Molecular Mass: 26.3 kDa
• AA Sequence: MSAKRAELKKTHLSKNYKAVCLELKPEPTKTFDYKAVKQEGRFTKAGVTQDLKNELREVREELKEKMEEIKQIKDLMDKDFDKLHEFVEIMKEMQKDMDEKMDILINTQKNYKLPLRRAPKEQQELRLMGKTHREPQLRPKKMDGASGVNGAPCALHKKTMAPQKTKQGSLDPLHHCGTCCEKCLLCALKNNYNRGNIPSEASGLYKGGEEPVTTQPSVGHAVPAPKSQTEGRTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: TEX35 testis expressed 35 [ Homo sapiens (human) ]
• Official Symbol: TEX35
• Synonyms: TEX35; testis expressed 35; TSC24; C1orf49; testis-expressed protein 35; Testis-Specific Conserved gene 24kDa; testis-expressed sequence 35 protein
• Gene ID: 84066
• mRNA Refseq: NM_032126
• Protein Refseq: NP_115502
• UniProt ID: Q5T0J7