Recombinant Human TEX29 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | TEX29-6495H |
Product Overview : | C13orf16 MS Standard C13 and N15-labeled recombinant protein (NP_689537) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | TEX29 (Testis Expressed 29) is a Protein Coding gene. |
Molecular Mass : | 16.6 kDa |
AA Sequence : | MEYVLEVKNSPRHLLKQFTVCDVPLYDICDYNVSRDRCQELGCCFYEGVCYKKAVPIYIHVFSALIVIIAGAFVITIIYRVIQESRKEKAIPVDVALPQKSSEKAELASSSSKLGLKPASPGPPSAGPSMKSDEDKDDVTGTITEAEETEDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | TEX29 testis expressed 29 [ Homo sapiens (human) ] |
Official Symbol | TEX29 |
Synonyms | TEX29; testis expressed 29; C13orf16; bA474D23.1; testis-expressed protein 29; testis-expressed sequence 29 protein |
Gene ID | 121793 |
mRNA Refseq | NM_152324 |
Protein Refseq | NP_689537 |
UniProt ID | Q8N6K0 |
◆ Recombinant Proteins | ||
TEX29-6022R | Recombinant Rat TEX29 Protein | +Inquiry |
TEX29-522H | Recombinant Human TEX29 Protein, GST-tagged | +Inquiry |
TEX29-5681R | Recombinant Rat TEX29 Protein, His (Fc)-Avi-tagged | +Inquiry |
Tex29-6368M | Recombinant Mouse Tex29 Protein, Myc/DDK-tagged | +Inquiry |
TEX29-6495H | Recombinant Human TEX29 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
TEX29-8304HCL | Recombinant Human C13orf16 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TEX29 Products
Required fields are marked with *
My Review for All TEX29 Products
Required fields are marked with *
0
Inquiry Basket