Recombinant Human TEX29 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: TEX29-6495H
• Product Overview: C13orf16 MS Standard C13 and N15-labeled recombinant protein (NP_689537) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: TEX29 (Testis Expressed 29) is a Protein Coding gene.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 16.6 kDa
• AA Sequence: MEYVLEVKNSPRHLLKQFTVCDVPLYDICDYNVSRDRCQELGCCFYEGVCYKKAVPIYIHVFSALIVIIAGAFVITIIYRVIQESRKEKAIPVDVALPQKSSEKAELASSSSKLGLKPASPGPPSAGPSMKSDEDKDDVTGTITEAEETEDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: TEX29 testis expressed 29 [ Homo sapiens (human) ]
• Official Symbol: TEX29
• Synonyms: TEX29; testis expressed 29; C13orf16; bA474D23.1; testis-expressed protein 29; testis-expressed sequence 29 protein
• Gene ID: 121793
• mRNA Refseq: NM_152324
• Protein Refseq: NP_689537
• UniProt ID: Q8N6K0