Recombinant Human TEX26 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | TEX26-4371H |
Product Overview : | C13orf26 MS Standard C13 and N15-labeled recombinant protein (NP_689538) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Description : | TEX26 (Testis Expressed 26) is a Protein Coding gene. |
Source : | HEK293 |
Species : | Human |
Tag : | Myc&DDK |
Molecular Mass : | 33.6 kDa |
AA Sequence : | MEQPGPRAPDPSLCHHNLQPTDDPNWDSYATTMRTAFTPKTGAVPALIRQNGIRRLGYTYSLSDPILNQTQYSDEYTWKSHSKEDLIKTETSRGIKSHKSHLNEDIFLWTLPHCQQTGTLKNCLPWKIPASMKEVNKALSNQFISLTKRDFVDRSKAQKIKKSSHLSLEWKKLLPQPPDTEFRRNYQIPAKIPELQDFSFKYGCYSSLPVASQGLVPSVLHSYLRNQEHTKKQTTYQSDYDKTYPDFLMLLNSFTSSQVKEYLQSLSYKDRQIIDRFIRTHCDTNKKKKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | TEX26 testis expressed 26 [ Homo sapiens (human) ] |
Official Symbol | TEX26 |
Synonyms | TEX26; testis expressed 26; C13orf26; testis-expressed protein 26; testis-expressed sequence 26 protein |
Gene ID | 122046 |
mRNA Refseq | NM_152325 |
Protein Refseq | NP_689538 |
UniProt ID | Q8N6G2 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All TEX26 Products
Required fields are marked with *
My Review for All TEX26 Products
Required fields are marked with *
0
Inquiry Basket