Recombinant Human TEX26 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : TEX26-4371H
Product Overview : C13orf26 MS Standard C13 and N15-labeled recombinant protein (NP_689538) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : TEX26 (Testis Expressed 26) is a Protein Coding gene.
Molecular Mass : 33.6 kDa
AA Sequence : MEQPGPRAPDPSLCHHNLQPTDDPNWDSYATTMRTAFTPKTGAVPALIRQNGIRRLGYTYSLSDPILNQTQYSDEYTWKSHSKEDLIKTETSRGIKSHKSHLNEDIFLWTLPHCQQTGTLKNCLPWKIPASMKEVNKALSNQFISLTKRDFVDRSKAQKIKKSSHLSLEWKKLLPQPPDTEFRRNYQIPAKIPELQDFSFKYGCYSSLPVASQGLVPSVLHSYLRNQEHTKKQTTYQSDYDKTYPDFLMLLNSFTSSQVKEYLQSLSYKDRQIIDRFIRTHCDTNKKKKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name TEX26 testis expressed 26 [ Homo sapiens (human) ]
Official Symbol TEX26
Synonyms TEX26; testis expressed 26; C13orf26; testis-expressed protein 26; testis-expressed sequence 26 protein
Gene ID 122046
mRNA Refseq NM_152325
Protein Refseq NP_689538
UniProt ID Q8N6G2

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All TEX26 Products

Required fields are marked with *

My Review for All TEX26 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon