Recombinant Human TEP1 protein, GST-tagged

• Cat.No.: TEP1-592H
• Product Overview: Recombinant Human TEP1(2529 a.a. - 2627 a.a.), fussed with GST at N-terminal, was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• ProteinLength: 2529 a.a. - 2627 a.a.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 36.63 kDa
• AA Sequence: ASMDSDASMDSEPTPHLKTRQRRKIHSGSVTALHVLPELLVTASKDRDVKLWERPSMQLLGLFRCEGSVSCLEPW LGANSTLQLAVGDVQGNVYFLNWE
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: TEP1 telomerase-associated protein 1 [ Homo sapiens ]
• Official Symbol: TEP1
• Synonyms: TEP1; telomerase-associated protein 1; telomerase protein component 1; p240; TLP1; TP1; TROVE domain family; member 1; TROVE1; VAULT2; telomerase protein 1; p80 telomerase homolog; TROVE domain family, member 1
• Gene ID: 7011
• mRNA Refseq: NM_007110
• Protein Refseq: NP_009041
• MIM: 601686
• UniProt ID: Q99973
• Chromosome Location: 14q11.2
• Function: ATP binding; RNA binding; nucleotide binding; contributes_to telomerase activity